IP Lookup Details:
IP Information - 51.210.90.250
Host name: ip250.ip-51-210-90.eu
Country: France
Country Code: FR
Region:
City:
Latitude: 48.8582
Longitude: 2.3387
CIDR: 51.0.0.0/8
NetName: RIPE-ERX-51
NetHandle: NET-51-0-0-0-1
Parent: ()
NetType: Early Registrations, Maintained by RIPE NCC
OriginAS:
Organization: RIPE Network Coordination Centre (RIPE)
RegDate: 1991-09-16
Updated: 2013-01-14
Comment: These addresses have been further assigned to users in the RIPE NCC region. Contact information can be found in the RIPE database at http://www.ripe.net/whois
Ref: https://rdap.arin.net/registry/ip/51.0.0.0
ResourceLink: https://apps.db.ripe.net/search/query.html
ResourceLink: whois.ripe.net
OrgName: RIPE Network Coordination Centre
OrgId: RIPE
Address: P.O. Box 10096
City: Amsterdam
StateProv:
PostalCode: 1001EB
Country: NL
RegDate:
Updated: 2013-07-29
Ref: https://rdap.arin.net/registry/entity/RIPE
ReferralServer: whois://whois.ripe.net
ResourceLink: https://apps.db.ripe.net/search/query.html
OrgTechHandle: RNO29-ARIN
OrgTechName: RIPE NCC Operations
OrgTechPhone: +31 20 535 4444
OrgTechEmail: hostmaster@ripe.net
OrgTechRef: https://rdap.arin.net/registry/entity/RNO29-ARIN
OrgAbuseHandle: ABUSE3850-ARIN
OrgAbuseName: Abuse Contact
OrgAbusePhone: +31205354444
OrgAbuseEmail: abuse@ripe.net
OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3850-ARIN
ENGLISH Version : Hello Webmasters of Society zellaklaimaol.com, and SIGNAL SPAM, LA POSTE, and EUROPOL ( in hidden copies ), Again these same emails of bank Phishing in December 2020, since year 2007 ( all Datafiles with HTML codes storaged ) ! Today Sunday 06 December 2020 after 20h07 PM ( always by nights or early mornings, or week-ends, or before or after opening of Offices and Administrations in FRANCE, I have just receive again this same email of Bank phishing in name of French CPAM ( Ameli.fr ) from email stolen : newsletter@zellaklaimaol.com and ( again ) from IP addresses from the PC or Smartphone of theses crazy hackers : 51.210.90.250 Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) using address IP and emails from Society zellaklaimaol.com Herebelow ( after French Version ) this complete email with all references HTML : VERSION FRANÇAISE : RECEPTION nouvel email d’escroquerie usurpant la CPAM, et AMELI.fr en France avec adresse email émettrice bidon : Bonjour Webmasters de SIGNAL SPAM, de AMELI.fr, de la CPAM, et LA POSTE.net, Et ces escroqueries continuent encore en Décembre 2020, et ceci depuis au moins +13 années ( archivés complets avec tous leurs codes HTML depuis 2007 ) ! CE soir Dimanche 06 Décembre 2020 après 20h07 du soir ( souvent soit les nuits, ou tôt les matinées, les week-ends, ou avant ou après les ouvertures ou fermetures des Bureaux et Administrations en France )( méthodes d’escrocs et de faux culs ) j'ai encore reçu sur ma boite email ( ele.lemoine@laposte.net ) ce même email ci-dessous d’escroquerie usurpant la CPAM et venant cette fois-ci de l'adresse email d’escroquerie: newsletter@zellaklaimaol.com L’adresse IP utilisée par le PC ou le smartphone de ces hackers fous est : 51.210.90.250 Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) IP Lookup Details: IP Information - 51.210.90.250 Host name: ip250.ip-51-210-90.eu Country: France Country Code: FR Region: City: Latitude: 48.8582 Longitude: 2.3387 utilisant aussi les emails de la Société zellaklaimaol.com C'est clairement une tentative d’escroquerie usurpant la CPAM et AMELI.fr ! Ci-dessous cet email d’escroquerie avec ces en-têtes complets : ************************************************************ CPAMFR : Dossier Réf : AML912-10-035 • Aujourd'hui, à 20:07 (il y a une heure) • • • De : Finalisez votre demande • A : ele.lemoine@laposte.net • Bonjour Malgré plusieurs relances téléphoniques et courriers, nous constatons que vous avez toujours uniremboursementidisponible sur votre espaceipersonnel d'un montant de 495,75 € . Le RIBlenregistré sur votre espaceipersonnel n'a pas pu être créditélpour le motif suivant : 1. Le numéro de téléphone enregistré sur votre espace personnel ne correspond pas à celui associé à votre compteibancaire. Pour accepter leipaiementlrapide en ligne, cliquez sur le lien suivant et sélectionnez une;méthode deiremboursementl. • Modifier vos informations personnelles. • Valider votre demande avec un code de confirmation SMS. Cordialement, Votre correspondant de l'assuranceiMaladie. Adresse : 50 Avenue du Professeur André Lemierre, 75020 Paris ********************** CODE HTML ci-dessous ********************************** Return-Path : <newsletter@zellaklaimaol.com> Received : from mlpnf0114.laposte.net (mlpnf0114.sys.meshcore.net [10.94.128.93]) by mlpnb0108 with LMTPA; Sun, 06 Dec 2020 20:07:48 +0100 X-Cyrus-Session-Id : cyrus-324637-1607281668-2-4448574164045256346 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.2.0","queueID":"4Cpwtr2LcCzjWvp","contextId":"c82ceaa4-bb95-4abd-b93c-b7dfa06930a0"} X-ppbforward : {"queueID":"4Cpwtr2LcCzjWvp","server":"mlpnf0114"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0114.laposte.net (SMTP Server) with ESMTP id 4Cpwtr2LcCzjWvp for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Sun, 6 Dec 2020 20:07:48 +0100 (CET) X-mail-filterd : {"version":"1.2.0","queueID":"4Cpwtr1XkqzjWvw","contextId":"12d51882-292b-4c55-8ff7-486f1f240596"} X-lpn-mailing : LEGIT X-lpn-spamrating : 40 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=newsletter@zellaklaimaol.com smtp.helo=zellaklaimaol.com; dkim=none; dmarc=pass reason="SPF is aligned, DKIM is not aligned" X-List-Unsubscribe : <https://zellaklaimaol.com?mailpoet_router&endpoint=track&action=click&data=WyI0OTIiLCJqb2JucWJ4a3NqNHNrMGs4c3c4a3drczhvNHcwZzRnYyIsIjciLCJjYzA2NDBkYTFjNzAiLGZhbHNlXQ> X-lpn-spamcause : OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedujedrudejvddguddvvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfntefrqffuvffgpdggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepvffufffhrhfkoffjgggtgfesrgekreerhedtjeenucfhrhhomhephfhinhgrlhhishgviicuvhhothhrvgcuuggvmhgrnhguvgcuoehnvgifshhlvghtthgvrhesiigvlhhlrghklhgrihhmrgholhdrtghomheqnecuggftrfgrthhtvghrnhepvedthefftedugfelkeeggffggfdutdfgteevueelgfegieevuddtteeihfdvgfegnecuffhomhgrihhnpeiivghllhgrkhhlrghimhgrohhlrdgtohhmnecukfhppeehuddrvddutddrledtrddvhedtnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehhvghlohepiigvlhhlrghklhgrihhmrgholhdrtghomhdpihhnvghtpeehuddrvddutddrledtrddvhedtpdhmrghilhhfrhhomhepnhgvfihslhgvthhtvghrseiivghllhgrkhhlrghimhgrohhlrdgtohhmpdhrtghpthhtohepvghlvgdrlhgvmhhoihhnvgeslhgrphhoshhtvgdrnhgvth Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0114.laposte.net (SMTP Server) with ESMTPS id 4Cpwtr1XkqzjWvw for <ele.lemoine@laposte.net>; Sun, 6 Dec 2020 20:07:48 +0100 (CET) Received : by zellaklaimaol.com (Postfix, from userid 10000) id CBB3098A1514; Sun, 6 Dec 2020 19:07:41 +0000 (UTC) To : ele.lemoine@laposte.net Subject : CPAMFR : Dossier Réf : AML912-10-035 Date : Sun, 6 Dec 2020 19:07:41 +0000 From : Finalisez votre demande <newsletter@zellaklaimaol.com> Reply-To : Finalisez votre demande <sterilisationa@aol.com> Message-ID : <iRBKKcRWRXJe3E2zBNSVCbfae1J28TbAAuFUPiAnYs@zellaklaimaol.com> X-Mailer : PHPMailer 6.1.6 (https://github.com/PHPMailer/PHPMailer) List-Unsubscribe : https://zellaklaimaol.com?mailpoet_router&endpoint=track&action=click&data=WyI0OTIiLCJqb2JucWJ4a3NqNHNrMGs4c3c4a3drczhvNHcwZzRnYyIsIjciLCJjYzA2NDBkYTFjNzAiLGZhbHNlXQ MIME-Version : 1.0 Content-Type : multipart/alternative; boundary="b1_iRBKKcRWRXJe3E2zBNSVCbfae1J28TbAAuFUPiAnYs" Content-Transfer-Encoding : 8bit